Cibarious logo
HomeIngredientsNoodlesRice NoodlesHo Fun

Ho Fun - What It Is, How to Buy It, and How to Use It

A silky river of rice transformed into wide, glossy ribbons that command the wok with quiet authority.

Curated by the Cibarious Editorial Team

Last reviewed: november 2025

Even gastronauts make mistakes sometimes! Cibarious aims for accuracy, but please always check mission-critical intel like allergens and substitutions. Nutritional values are database estimates. See our Terms of Use & Editorial Policy.

Ho Fun—those gloriously wide, slippery rice noodles—are the uncontested champions of Cantonese comfort food. You might be curious about them after spotting them in a restaurant's char kway teow or beef chow fun, or perhaps you're ready to master the art of wok-tossed noodles at home. Either way, these translucent sheets have a particular magic: they soak up flavor while maintaining their distinctive slick texture, transforming humble ingredients into something extraordinary.
This guide will walk you through everything from selecting quality ho fun to storing them properly, with plenty of tips for getting that restaurant-quality wok hei at home.
Want just the essentials? Skim the headers. Curious about the cultural significance and science behind these noodles? Keep reading.

🚀 Jump to the Deep Dive

👉 Not sure if you're a ho fun newbie or already a rice noodle enthusiast? Stick around for the basics, then hop to the deep dive when you're ready to get your PhD in Rice Noodleology.

You can also jump to any section using the table of contents or continue reading below for the essential guide.

Need bigger text?

Click the to adjust your reading size.
Because good taste always deserves comfortable reading.

📖 Essential Ho Fun Guide

🍜 What are Ho Fun?

Ho Fun's history stretches back centuries in southern China, particularly in Guangdong province, where rice cultivation has long been central to the cuisine. These wide, flat noodles became a staple in Cantonese cooking, valued for their ability to quickly absorb flavors while maintaining their distinctive texture.
There are several varieties of these broad rice noodles, distinguished primarily by width and thickness. Fresh ho fun comes in sheets that can be cut to desired widths, while pre-cut ho fun are ready to use in stir-fries. Dried ho fun (less common but available) requires soaking before use, and rolled ho fun are often used for soup noodles or filled with ingredients like shrimp or beef.

🏭 Where are Ho Fun Produced?

Ho fun originate from southern China, particularly the Guangdong region, where rice-based foods dominate the culinary landscape. The best ho fun are produced where rice cultivation thrives and traditional noodle-making techniques have been preserved across generations. Climate and water quality significantly impact the texture and flavor, with the soft water of Pearl River Delta particularly prized for producing silky, tender noodles.
The world of ho fun production extends beyond China, with significant manufacturing occurring throughout Southeast Asia.
Biggest Producers
  1. China Home to traditional production methods, particularly in Guangdong province
  2. Hong Kong Known for fresh, restaurant-quality noodles with optimal slipperiness
  3. Malaysia Produces variants used in popular dishes like char kway teow
Not all ho fun deliver the same eating experience. Production methods, rice varieties, and water quality all contribute to their final texture.
Best Quality Ho Fun
  • Guangzhou, China Shahe fen. Known for exceptional texture due to specific rice varieties and soft water, best for authentic Cantonese dishes
  • Hong Kong Gon chow ngau ho. Slightly chewier noodles perfect for stir-frying with minimal breakage
  • Ipoh, Malaysia Kuey teow. Distinguished by their silky texture and ability to absorb robust flavors
The winner: Why Guangzhou ho fun excels lies in both tradition and terroir. The combination of traditional milling techniques, specific rice varieties, and the minerality of the Pearl River Delta water creates noodles with the perfect balance of chewiness and silkiness. The slightly alkaline water contributes to that distinctive slippery texture that prevents clumping during cooking. Additionally, many traditional producers in Guangzhou still follow time-honored methods of steaming the rice slurry to create the perfect delicate sheets.

📦 Ho Fun: How They Come to You

Ho fun are available in several forms, each suited to different cooking applications:
  • 🥡 Fresh sheets Uncut folded sheets that can be sliced to desired width, ideal for wrapping fillings or cutting to size
  • 🍲 Pre-cut fresh noodles Ready-to-cook wide strips perfect for stir-fries and quick meals
  • 🥢 Refrigerated packets Partially pre-cooked noodles that require minimal preparation, good for beginners
  • 📦 Dried ho fun Shelf-stable option requiring soaking before use, convenient but less authentic texture
  • 🥫 Vacuum-sealed fresh noodles Premium option with extended shelf life that maintains authentic texture

🌱 Seasonal Product Guide

While rice noodles themselves aren't seasonal, the production quality can vary throughout the year due to rice harvesting cycles. The freshness window for ho fun is relatively short, making proper storage crucial.
  • 🌸 Spring Prime time for fresh noodles as new rice crops become available in many Asian regions, offering better texture and flavor.
  • 🌞 Summer High humidity can affect noodle production; quality may vary, but generally still good availability.
  • 🍂 Fall Second rice harvest in many regions leads to another peak in quality; excellent time to purchase.
  • Winter Rely more on vacuum-sealed or refrigerated options as fresh production may slow in some regions.

🧐 How to Choose the Best Ho Fun

Fresh ho fun should be pliable yet firm, with a distinct translucency that signals proper steaming. Beware of overly stiff or crumbly noodles that will break during cooking!
Appearance
  • Color Look for translucent white noodles with a slight sheen; avoid yellowing or dull appearance.
  • Surface Fresh vs. dried: fresh offers superior texture and authenticity for stir-fries.
  • Integrity Noodles should be intact without excessive tears or breakage, especially for stir-fry applications.
Aroma
  • Neutral, clean scent Fresh rice noodles should have a subtle, clean aroma with no sourness.
  • Freshness test If possible, give packaged noodles a gentle squeeze; they should feel slightly moist but not sticky.
  • Off smells? Any sour or fermented aroma indicates spoilage; avoid these packets.
Texture
  • Flexibility Quality ho fun bend without breaking when fresh; they should feel silky but not sticky.
  • Moisture level Properly made noodles feel moist to touch but not wet or slimy.
  • Warning signs Excessive stickiness or dryness indicates poor quality or improper storage.

👃 Sensory Profile

Ho fun deliver a subtle rice fragrance that serves as a canvas for stronger flavors. Their taste is mild with a slight natural sweetness from the rice, allowing them to absorb sauces without competing with other ingredients. The texture is distinctly slippery and tender with just enough resistance to offer a satisfying chew. When properly cooked, they should have a silky-smooth mouthfeel with a delicate skin-like exterior that gives way to a soft, yielding interior. The pleasure of ho fun lies primarily in this textural interplay rather than pronounced flavor.

🧭 Other Factors to Consider

When choosing ho fun, quality indicators extend beyond just appearance to include packaging and freshness dating.
  • Production date Fresh ho fun have a short shelf life; always check the production date for maximum freshness
  • Packaging integrity Look for well-sealed packages without excess moisture or condensation inside
  • Refrigeration Quality fresh noodles should be properly refrigerated at the store, not sitting at room temperature
  • Separation techniques Some premium brands use thin sheets of plastic or paper between noodle layers to prevent sticking
  • Ingredients list Traditional ho fun contain primarily rice flour and water; additives may indicate lower quality

🧊 How to Store Ho Fun Properly

Proper storage is crucial for ho fun as their texture degrades quickly once exposed to air. Follow these guidelines for best results:
  • Fresh sheet ho fun Refrigerate, tightly wrapped in plastic, for up to 2 days.
  • Pre-cut fresh noodles Store in airtight container with a damp paper towel for up to 3 days.
  • Vacuum-sealed noodles Keep refrigerated in original packaging until opening; use within the date specified.
  • Dried ho fun Store in cool, dry place for up to 6 months.

📌 Final Thoughts on Ho Fun

Ho fun might appear simple—just wide rice noodles—but they're the foundation of countless beloved dishes across Asia. Their magic lies in their ability to transform: silky and slippery one moment, caramelized with wok hei the next. Whether starring in classic beef chow fun or soaking up the complex flavors of Malaysian char kway teow, they offer an accessible entry point to authentic Asian cooking.
For best results, always seek the freshest noodles possible and never overcook them—a quick toss in a screaming-hot wok is all they need to shine.
The humble ho fun teaches us that sometimes the simplest ingredients, treated with respect, deliver the most profound culinary pleasures. 🍜

🛒 How to Buy Ho Fun: Physical & Online Shopping

🛍 What to buy

Preferred Varieties by Region
  • Hong Kong & Guangdong Look for “鮮河粉” (sin ho fun) stamped on the packet—snow-white, glossy, and slightly elastic from a touch of tapioca starch. These steam into supple folds without tearing.
  • Thailand “Sen Yai” (literally “big strip”) is the local cousin—a touch wider and more delicate, often sold rolled like scrolls in banana leaf. Great for stir-fries that need quick char.
  • Vietnam “Bánh Phở Tươi”—same DNA, thinner and more translucent, meant for pho but works as Ho Fun in a pinch if you like a silkier bite.
What to Look For
  • Fresh packs should feel cool, slightly tacky, and emit a clean rice aroma—no sour tang. Vacuum-sealed is okay; bloated packs are not.
  • Dried sheets labeled “banh cuon” or “rice sticks, extra wide”—look for off-white color; chalky bright white often means bleaching.
  • Red flags: any pink or grey spots, slimy surface, or ingredient list longer than four items (rice, water, tapioca, salt).
Use-Based Recommendations
  • Best for Raw Use Fresh Hong Kong sheets—cut into cool salad ribbons or wrap around blanched greens.
  • Best for Cooking Vacuum-packed Thai Sen Yai—stands up to searing in a wok without shredding.
  • Budget Pick Dried extra-wide rice sticks—soak 20 min, cheaper per gram, and shelf-stable for months.

💰 What’s a Fair Price?

  • Fresh sheets: US$2–3 per 400 g pack in North America; £1.80–2.50 in the UK; €2–3 in much of the EU.
  • Vacuum-sealed: slight premium, adds 20–30 %.
  • Dried: US$1.50–2.50 per 400 g bag globally; suspiciously cheap bags are often brittle and snap during soaking.

🧺 Local Shops & Markets

  • Supermarkets: Large chains like H Mart (US), T&T (Canada), or NTUC FairPrice (Singapore) keep fresh packets near the tofu.
  • Ethnic grocers: Vietnamese or Cantonese butchers often stock house-made sheets—ask for “banh uot” if the staff looks puzzled.
  • Farmer’s markets: rare, but look for rice-cake stalls that roll fresh cheung fun to order on weekends.

🌐 Online Options

  • USA/Canada: Amazon, Weee!, or 99ranch.com—search “fresh rice noodle sheets” or “hor fun.”
  • UK/EU: Oseyo, Sous Chef, or Yumbles—filter by “fresh” and check the dispatch date; anything older than 3 days risks souring.
  • Australia/NZ: Asian Pantry, Coles Online (look in “Asian chilled”).
Tips for Ordering Ho Fun from Abroad
  • Check Shipping Costs Chilled overnight can double the noodle price—bundle with tofu or kimchi to justify.
  • Freshness Guarantees Choose sellers who pack with ice packs and offer refunds for bloated packs.
  • Buy in Bulk Vacuum packs freeze well; portion into meal-size stacks separated by baking paper.
  • Customer Reviews Scan for keywords “arrived intact,” “no sour smell,” “still soft.”

🌍 Where to Look

North America (NA)

  • United States Nationwide at H Mart, 99 Ranch, and select Kroger “Oriental” coolers. Dried sticks in every Walmart.
  • Canada T&T, Lucky Supermarket (Calgary), and T&T’s online grocery.
  • Mexico Super City (Mexico City) and Asian-owned corner stores in Polanco carry vacuum-packed Thai brands.

Europe, Middle East, and Africa (EMEA)

  • European Union Paris’s 13th arrondissement Tang Frères, Berlin’s Dong Xuan Center, and Amsterdam’s Amazing Oriental all stock fresh sheets.
  • United Kingdom Sainsbury’s “World Foods” fridge, Wing Yip, and Oseyo online.
  • Middle East Carrefour UAE (Dubai) and LuLu Hypermarket—look in the “Asian chilled” bay.
  • Africa Shoprite (South Africa) and Game Stores in Nairobi import Thai vacuum packs.

Asia-Pacific (APAC)

  • Oceania Coles & Woolworths (AU) stock “Chang’s Fresh Rice Noodles next to tofu; Countdown (NZ) carries similar.
  • East Asia Any wet market steam table in Guangzhou will sell them hot; Don Quijote in Tokyo stocks chilled Thai imports.
  • Southeast Asia Ubiquitous at wet markets and 7-Eleven chiller shelves in Bangkok.
  • South Asia Nature’s Basket (India) and Keells (Sri Lanka) import vacuum packs from Thailand.

Latin America (LATAM)

  • Central & South America Supermercado Jumbo (Chile) and Hipermercado Carulla (Colombia) carry dried sticks; fresh is rare.
  • Caribbean Hi-Lo Food Stores (Trinidad) and Supermercado Nacional (DR) stock vacuum-sealed Thai brands.

🔄 If You Can’t Find It

Slice fresh lasagna sheets made from rice flour—blanch 10 sec in salted water and oil lightly. Or rehydrate extra-wide dried pad-thai noodles until floppy; they’ll mimic the chew but lack the silky drape. In a pinch, Vietnamese bánh cuốn batter steamed thinly on a greased plate does the trick—just roll and slice.

🧠 Deep Dive: Ho Fun Beyond the Basics

🔪 Culinary Techniques & Handling

  • Separation technique Gently peel apart fresh noodles with oiled fingers to prevent tearing
  • Controlling stickiness Brief rinse in room temperature water helps remove excess starch; drain thoroughly before stir-frying
  • Common mistakes Overcrowding the wok leads to steaming rather than proper searing; cook in batches for best texture
  • Oil preparation Lightly coating noodles with oil after rinsing prevents clumping before they hit the wok
  • Temperature management Ho fun require high heat and quick cooking; they continue softening off-heat
  • Regional twist In Guangdong, ho fun are often used in "dry-fried" dishes with minimal sauce, allowing the noodles to develop subtle caramelization. By contrast, in Malaysia, the same noodles absorb more sauce in char kway teow, developing a deeper color and more intense flavor. Singapore-style ho fun typically incorporate more vegetables and a lighter sauce that coats rather than soaks into the noodles.

🍜 How Ho Fun Compares

IngredientWidth/ThicknessTexture ProfileCommon Uses
Ho FunWide (≥1 cm)Slippery, chewyStir-fries, rolled dishes
Rice VermicelliVery thinDelicate, lightSoups, spring rolls, cold dishes
Sen YaiSimilar to ho funSlightly firmerThai stir-fries, pad see ew
Chow FunSame as ho funIdenticalAlternative name in some regions
This comparison helps position ho fun within the broader family of Asian rice noodles, supporting better substitutions and understanding of how width and production method affect cooking applications.

🔁 Substitutions: Ho Fun's Stand-Ins

When you can't find fresh ho fun, these alternatives can save your stir-fry aspirations:
  • Fresh rice noodle sheets Replicates both texture and appearance - simply cut to width needed.
  • Thai Sen Yai Replicates both flavor and texture with minimal difference in appearance.
  • Shahe fen Different name for the same product - replicates both texture and appearance.
SubstituteRatioNotes
Wide dried rice sticks1:1 (after soaking)Lacks the fresh texture but works in saucier dishes
Fresh Italian fettuccine1:1Different flavor but similar width; use for texture only

🥂 Pairings: Ho Fun's Best Friends

Ho fun's neutral canvas welcomes bold flavors and contrasting textures:
  • Beef and black bean sauce The savory depth of fermented black beans complements ho fun's mild sweetness. This classic pairing appears in beef chow fun, where the noodles soak up the umami-rich sauce.
  • Chinese broccoli (gai lan) The slight bitterness and crunch of gai lan balances the softness of ho fun. Traditional Cantonese stir-fries often incorporate this vegetable for textural contrast.
  • Soy sauce and sugar The caramelization of this simple combination on high heat creates wok hei and gives the noodles their characteristic brown edges. The sweetness enhances ho fun's natural rice flavor.

🔬 Why Ho Fun Works: The Science & The Magic

Ho fun's distinctive properties come from its unique composition and preparation method. The noodles are gluten-free, making them suitable for those with wheat allergies or celiac disease.
  • Amylopectin structure Contains high levels of amylopectin, a branched starch that creates the characteristic chewy-slippery texture
  • Gelatinization process When steamed, rice starches undergo complete gelatinization, creating ho fun's translucent appearance
  • Low protein content The absence of gluten and low protein content contributes to ho fun's tender texture
  • Surface structure The smooth surface created during steaming allows for excellent sauce adhesion while maintaining slip

🌍 Cultural Significance

  • Cantonese staple Ho fun symbolizes prosperity in Cantonese cuisine, with their length representing longevity
  • Diaspora evolution As Cantonese immigrants settled throughout Southeast Asia, ho fun adapted to local tastes, spawning variants like Malaysia's char kway teow
  • Festival food During Lunar New Year celebrations, dishes featuring ho fun represent good fortune and unbroken family bonds
  • Colonial influence British colonization of Hong Kong introduced Western ingredients to ho fun dishes, creating fusion variants
  • Street food icon Ho fun transitioned from home cooking to beloved street food, with vendors developing specialized techniques
  • Common misconception Many Westerners confuse ho fun with other Asian noodles; understanding their specific properties is key to authentic preparation

🗺️ Global Footprint

Ho fun's influence extends far beyond its Cantonese origins. From the sizzling woks of Hong Kong dai pai dong (open-air food stalls) to Malaysian hawker centers, these noodles adapt while maintaining their essential character. In Thailand, similar rice noodles form the base of pad see ew, while Vietnamese cuisine incorporates them into certain regional dishes. Chinese diaspora communities worldwide have preserved traditional ho fun preparations while developing new variations influenced by local ingredients.

🚀 Beyond the Stir-Fry: Unexpected Uses of Ho Fun

  • Dessert wrapper Fresh ho fun sheets can encase sweet fillings like red bean paste or mango
  • Crispy noodle chips Deep-frying creates crunchy snacks or garnishes for soups and salads
  • Rice paper alternative Fresh sheets work well as wrappers for spring rolls when cut properly
  • Lasagna substitute Layered with sauce and fillings for a gluten-free Asian-fusion dish

🕵️ Ho Fun Secrets: Fun Facts & Hidden Wonders

  • Ho fun's Cantonese name (河粉, hé fěn) translates to "river rice noodle," referencing their smooth, flowing texture
  • These noodles are sometimes called "Shahe fen" after Shahe Town in Guangzhou where they originated
  • The distinctive "wok hei" (breath of the wok) flavor in properly stir-fried ho fun comes from reactions between rice proteins and extremely high heat 🔥

📚 Cultural & Literary References

  • Tang Dynasty poetry Early references to broad rice noodles appear in poems describing everyday Cantonese life
  • "A Taste of Old Hong Kong" "The sizzle of beef chow fun hitting the wok remains the soundtrack of my childhood."
  • Wong Kar-wai films Hong Kong cinema often features characters sharing meals of ho fun, symbolizing everyday connection
These references show how ho fun has transcended its humble origins to become a cultural touchstone representing Cantonese identity and comfort food across generations.

🌱 Ethical & Environmental Considerations

  • Rice cultivation impact Rice farming for ho fun production requires significant water resources.
  • Organic options Organic rice noodles are increasingly available, reducing pesticide use in production.
  • Processing energy Traditional steaming methods require less energy than mechanical drying processes.
  • Local production Fresh ho fun has a short shelf life, encouraging local production and reducing transportation emissions.
  • Water usage Rice cultivation is water-intensive; some producers are adopting more sustainable irrigation techniques.
  • Traditional methods Small-batch production often preserves traditional techniques that are less mechanized and energy-intensive.
  • Packaging concerns Fresh ho fun typically uses plastic packaging; some producers are exploring biodegradable alternatives.
  • Rice variety preservation Traditional ho fun production helps maintain demand for specific rice varieties, supporting agricultural diversity.

♻️ Sustainability Score

Rice noodles like ho fun generally have a moderate environmental footprint, primarily due to the water-intensive nature of rice cultivation. One kilogram of rice typically requires 2,500 liters of water to produce. However, compared to wheat-based noodles, rice noodles skip the energy-intensive baking process. The good news? The simple ingredients (primarily rice flour and water) mean fewer additives and chemicals. If you're looking to minimize impact, seek out producers using sustainable rice farming methods like the System of Rice Intensification (SRI), which can reduce water usage by up to 50% while maintaining yields.

Now Send Ho Fun Down the Line

Good cooks don't guess. They share, too!

Help other home chefs discover ho fun and its secrets.

Sources & Further Reading

Our comprehensive source citations and further reading recommendations are currently being compiled. This section will include academic references, culinary texts, and authoritative resources that informed this article. Check back soon for a curated list of sources to deepen your understanding of this ingredient.

Tags
slipperychewymildflatwidefreshstir fryingsoup baseabsorbing saucecantonesechineseeast asianmain courselunchdinnerquick cookstir friedboiledgluten freeveganlow fatrice basedplant basedtraditional methodrefrigeratedasian marketfreshfamily traditionclassiccomfort foodhome cook friendlychefs kissfoodie favoritemust trytalked aboutfoodie pick